PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g014790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 201aa    MW: 23104.8 Da    PI: 6.936
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g014790.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.23e-25958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gklye +
  Sopen11g014790.1  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELA 58
                      79*********************************************965 PP

2K-box57.84.8e-208417410100
             K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       ++++    ++e++ Lk+ei+ Lq+ +  + G + ++++l eL++Le+ Le  + +iRs K+++++++i+ l++ke  l+ +nk+L+ k++e
  Sopen11g014790.1  84 KDTQPLDPKEEINMLKNEIDVLQKGLSYMYGGGAGTMTLDELHSLEKYLEIWMYHIRSAKMDIMFQEIQLLKNKEGILEAANKYLQDKIDE 174
                       4555566789******************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-27173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.787161IPR002100Transcription factor, MADS-box
CDDcd002659.56E-40276No hitNo description
PRINTSPR004044.4E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-221056IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.89588178IPR002487Transcription factor, K-box
PfamPF014861.2E-2191172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKLYELATK  60
GSMQGLIERY IKSTKGVEVA EEAKDTQPLD PKEEINMLKN EIDVLQKGLS YMYGGGAGTM  120
TLDELHSLEK YLEIWMYHIR SAKMDIMFQE IQLLKNKEGI LEAANKYLQD KIDEQYTVTN  180
MTQNLTDFQC PLTVQNEIFQ F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-15159159Myocyte-specific enhancer factor 2B
1tqe_Q7e-15159159Myocyte-specific enhancer factor 2B
1tqe_R7e-15159159Myocyte-specific enhancer factor 2B
1tqe_S7e-15159159Myocyte-specific enhancer factor 2B
3kov_A7e-15259158Myocyte-specific enhancer factor 2A
3kov_B7e-15259158Myocyte-specific enhancer factor 2A
3kov_I7e-15259158Myocyte-specific enhancer factor 2A
3kov_J7e-15259158Myocyte-specific enhancer factor 2A
3p57_A7e-15259158Myocyte-specific enhancer factor 2A
3p57_B7e-15259158Myocyte-specific enhancer factor 2A
3p57_C7e-15259158Myocyte-specific enhancer factor 2A
3p57_D7e-15259158Myocyte-specific enhancer factor 2A
3p57_I7e-15259158Myocyte-specific enhancer factor 2A
3p57_J7e-15259158Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987370.0AY098737.2 Lycopersicon esculentum TAGL12 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233764.21e-149TAGL12 transcription factor isoform 1
RefseqXP_015057026.11e-149PREDICTED: agamous-like MADS-box protein AGL12 isoform X1
SwissprotQ388412e-81AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLK4D7P51e-149K4D7P5_SOLLC; Uncharacterized protein
STRINGSolyc11g032100.1.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA98102024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-82AGAMOUS-like 12